Anti C9orf85 pAb (ATL-HPA050767)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050767-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C9orf85
Alternative Gene Name: MGC61599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035171: 97%, ENSRNOG00000027161: 97%
Entrez Gene ID: 138241
Uniprot ID: Q96MD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS |
Gene Sequence | SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS |
Gene ID - Mouse | ENSMUSG00000035171 |
Gene ID - Rat | ENSRNOG00000027161 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C9orf85 pAb (ATL-HPA050767) | |
Datasheet | Anti C9orf85 pAb (ATL-HPA050767) Datasheet (External Link) |
Vendor Page | Anti C9orf85 pAb (ATL-HPA050767) at Atlas Antibodies |
Documents & Links for Anti C9orf85 pAb (ATL-HPA050767) | |
Datasheet | Anti C9orf85 pAb (ATL-HPA050767) Datasheet (External Link) |
Vendor Page | Anti C9orf85 pAb (ATL-HPA050767) |