Anti C9orf78 pAb (ATL-HPA021232 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021232-100
  • Immunohistochemistry analysis in human bone marrow and pancreas tissues using HPA021232 antibody. Corresponding C9orf78 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-C9orf78 antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 78
Gene Name: C9orf78
Alternative Gene Name: HCA59, HSPC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026851: 100%, ENSRNOG00000007532: 100%
Entrez Gene ID: 51759
Uniprot ID: Q9NZ63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYEKFK
Gene Sequence YHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYEKFK
Gene ID - Mouse ENSMUSG00000026851
Gene ID - Rat ENSRNOG00000007532
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C9orf78 pAb (ATL-HPA021232 w/enhanced validation)
Datasheet Anti C9orf78 pAb (ATL-HPA021232 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C9orf78 pAb (ATL-HPA021232 w/enhanced validation)



Citations for Anti C9orf78 pAb (ATL-HPA021232 w/enhanced validation) – 1 Found
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed