Anti C9orf72 pAb (ATL-HPA023873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023873-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C9orf72
Alternative Gene Name: MGC23980
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028300: 97%, ENSRNOG00000009478: 94%
Entrez Gene ID: 203228
Uniprot ID: Q96LT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| Gene Sequence | YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| Gene ID - Mouse | ENSMUSG00000028300 |
| Gene ID - Rat | ENSRNOG00000009478 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C9orf72 pAb (ATL-HPA023873) | |
| Datasheet | Anti C9orf72 pAb (ATL-HPA023873) Datasheet (External Link) |
| Vendor Page | Anti C9orf72 pAb (ATL-HPA023873) at Atlas Antibodies |
| Documents & Links for Anti C9orf72 pAb (ATL-HPA023873) | |
| Datasheet | Anti C9orf72 pAb (ATL-HPA023873) Datasheet (External Link) |
| Vendor Page | Anti C9orf72 pAb (ATL-HPA023873) |
| Citations for Anti C9orf72 pAb (ATL-HPA023873) – 7 Found |
| Busch, Johanna I; Unger, Travis L; Jain, Nimansha; Tyler Skrinak, R; Charan, Rakshita A; Chen-Plotkin, Alice S. Increased expression of the frontotemporal dementia risk factor TMEM106B causes C9orf72-dependent alterations in lysosomes. Human Molecular Genetics. 2016;25(13):2681-2697. PubMed |
| Shi, Yingxiao; Lin, Shaoyu; Staats, Kim A; Li, Yichen; Chang, Wen-Hsuan; Hung, Shu-Ting; Hendricks, Eric; Linares, Gabriel R; Wang, Yaoming; Son, Esther Y; Wen, Xinmei; Kisler, Kassandra; Wilkinson, Brent; Menendez, Louise; Sugawara, Tohru; Woolwine, Phillip; Huang, Mickey; Cowan, Michael J; Ge, Brandon; Koutsodendris, Nicole; Sandor, Kaitlin P; Komberg, Jacob; Vangoor, Vamshidhar R; Senthilkumar, Ketharini; Hennes, Valerie; Seah, Carina; Nelson, Amy R; Cheng, Tze-Yuan; Lee, Shih-Jong J; August, Paul R; Chen, Jason A; Wisniewski, Nicholas; Hanson-Smith, Victor; Belgard, T Grant; Zhang, Alice; Coba, Marcelo; Grunseich, Chris; Ward, Michael E; van den Berg, Leonard H; Pasterkamp, R Jeroen; Trotti, Davide; Zlokovic, Berislav V; Ichida, Justin K. Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons. Nature Medicine. 2018;24(3):313-325. PubMed |
| Snowden, Julie S; Rollinson, Sara; Thompson, Jennifer C; Harris, Jennifer M; Stopford, Cheryl L; Richardson, Anna M T; Jones, Matthew; Gerhard, Alex; Davidson, Yvonne S; Robinson, Andrew; Gibbons, Linda; Hu, Quan; DuPlessis, Daniel; Neary, David; Mann, David M A; Pickering-Brown, Stuart M. Distinct clinical and pathological characteristics of frontotemporal dementia associated with C9ORF72 mutations. Brain : A Journal Of Neurology. 2012;135(Pt 3):693-708. PubMed |
| Brettschneider, Johannes; Van Deerlin, Vivianna M; Robinson, John L; Kwong, Linda; Lee, Edward B; Ali, Yousuf O; Safren, Nathaniel; Monteiro, Mervyn J; Toledo, Jon B; Elman, Lauren; McCluskey, Leo; Irwin, David J; Grossman, Murray; Molina-Porcel, Laura; Lee, Virginia M-Y; Trojanowski, John Q. Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion. Acta Neuropathologica. 2012;123(6):825-39. PubMed |
| Satoh, Jun-Ichi; Tabunoki, Hiroko; Ishida, Tsuyoshi; Saito, Yuko; Arima, Kunimasa. Dystrophic neurites express C9orf72 in Alzheimer's disease brains. Alzheimer's Research & Therapy. 2012;4(4):33. PubMed |
| Wen, Xinmei; Tan, Wenzhi; Westergard, Thomas; Krishnamurthy, Karthik; Markandaiah, Shashirekha S; Shi, Yingxiao; Lin, Shaoyu; Shneider, Neil A; Monaghan, John; Pandey, Udai B; Pasinelli, Piera; Ichida, Justin K; Trotti, Davide. Antisense proline-arginine RAN dipeptides linked to C9ORF72-ALS/FTD form toxic nuclear aggregates that initiate in vitro and in vivo neuronal death. Neuron. 2014;84(6):1213-25. PubMed |
| Abo-Rady, Masin; Kalmbach, Norman; Pal, Arun; Schludi, Carina; Janosch, Antje; Richter, Tanja; Freitag, Petra; Bickle, Marc; Kahlert, Anne-Karin; Petri, Susanne; Stefanov, Stefan; Glass, Hannes; Staege, Selma; Just, Walter; Bhatnagar, Rajat; Edbauer, Dieter; Hermann, Andreas; Wegner, Florian; Sterneckert, Jared L. Knocking out C9ORF72 Exacerbates Axonal Trafficking Defects Associated with Hexanucleotide Repeat Expansion and Reduces Levels of Heat Shock Proteins. Stem Cell Reports. 2020;14(3):390-405. PubMed |