Anti C9orf64 pAb (ATL-HPA054903)

Atlas Antibodies

Catalog No.:
ATL-HPA054903-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 64
Gene Name: C9orf64
Alternative Gene Name: MGC10999
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021550: 79%, ENSRNOG00000019232: 82%
Entrez Gene ID: 84267
Uniprot ID: Q5T6V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS
Gene Sequence QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS
Gene ID - Mouse ENSMUSG00000021550
Gene ID - Rat ENSRNOG00000019232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C9orf64 pAb (ATL-HPA054903)
Datasheet Anti C9orf64 pAb (ATL-HPA054903) Datasheet (External Link)
Vendor Page Anti C9orf64 pAb (ATL-HPA054903) at Atlas Antibodies

Documents & Links for Anti C9orf64 pAb (ATL-HPA054903)
Datasheet Anti C9orf64 pAb (ATL-HPA054903) Datasheet (External Link)
Vendor Page Anti C9orf64 pAb (ATL-HPA054903)