Anti C9orf40 pAb (ATL-HPA042167 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042167-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-C9orf40 antibody. Corresponding C9orf40 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 40
Gene Name: C9orf40
Alternative Gene Name: FLJ10110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047044: 66%, ENSRNOG00000025644: 70%
Entrez Gene ID: 55071
Uniprot ID: Q8IXQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VASRQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDME
Gene Sequence VASRQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDME
Gene ID - Mouse ENSMUSG00000047044
Gene ID - Rat ENSRNOG00000025644
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C9orf40 pAb (ATL-HPA042167 w/enhanced validation)
Datasheet Anti C9orf40 pAb (ATL-HPA042167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C9orf40 pAb (ATL-HPA042167 w/enhanced validation)