Anti C9orf3 pAb (ATL-HPA072729)

Atlas Antibodies

SKU:
ATL-HPA072729-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 3
Gene Name: C9orf3
Alternative Gene Name: AOPEP, AP-O, APO, C90RF3, FLJ14675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021458: 86%, ENSRNOG00000017505: 90%
Entrez Gene ID: 84909
Uniprot ID: Q8N6M6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT
Gene Sequence LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT
Gene ID - Mouse ENSMUSG00000021458
Gene ID - Rat ENSRNOG00000017505
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C9orf3 pAb (ATL-HPA072729)
Datasheet Anti C9orf3 pAb (ATL-HPA072729) Datasheet (External Link)
Vendor Page Anti C9orf3 pAb (ATL-HPA072729) at Atlas Antibodies

Documents & Links for Anti C9orf3 pAb (ATL-HPA072729)
Datasheet Anti C9orf3 pAb (ATL-HPA072729) Datasheet (External Link)
Vendor Page Anti C9orf3 pAb (ATL-HPA072729)