Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053008-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C9orf24
Alternative Gene Name: bA573M23.4, CBE1, MGC32921, MGC33614, NYD-SP22, SMRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028441: 66%, ENSRNOG00000013320: 67%
Entrez Gene ID: 84688
Uniprot ID: Q8NCR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN |
| Gene Sequence | KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN |
| Gene ID - Mouse | ENSMUSG00000028441 |
| Gene ID - Rat | ENSRNOG00000013320 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) | |
| Datasheet | Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) | |
| Datasheet | Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) |
| Citations for Anti C9orf24 pAb (ATL-HPA053008 w/enhanced validation) – 1 Found |
| Amani, Vladimir; Donson, Andrew M; Lummus, Seth C; Prince, Eric W; Griesinger, Andrea M; Witt, Davis A; Hankinson, Todd C; Handler, Michael H; Dorris, Kathleen; Vibhakar, Rajeev; Foreman, Nicholas K; Hoffman, Lindsey M. Characterization of 2 Novel Ependymoma Cell Lines With Chromosome 1q Gain Derived From Posterior Fossa Tumors of Childhood. Journal Of Neuropathology And Experimental Neurology. 2017;76(7):595-604. PubMed |