Anti C9orf16 pAb (ATL-HPA020725)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020725-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C9orf16
Alternative Gene Name: EST00098, FLJ12823, MGC4639
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039195: 94%, ENSRNOG00000022681: 94%
Entrez Gene ID: 79095
Uniprot ID: Q9BUW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP |
| Gene Sequence | NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP |
| Gene ID - Mouse | ENSMUSG00000039195 |
| Gene ID - Rat | ENSRNOG00000022681 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C9orf16 pAb (ATL-HPA020725) | |
| Datasheet | Anti C9orf16 pAb (ATL-HPA020725) Datasheet (External Link) |
| Vendor Page | Anti C9orf16 pAb (ATL-HPA020725) at Atlas Antibodies |
| Documents & Links for Anti C9orf16 pAb (ATL-HPA020725) | |
| Datasheet | Anti C9orf16 pAb (ATL-HPA020725) Datasheet (External Link) |
| Vendor Page | Anti C9orf16 pAb (ATL-HPA020725) |
| Citations for Anti C9orf16 pAb (ATL-HPA020725) – 1 Found |
| Chen, Xiaojun; Zhang, Hong; Xiao, Bo. C9orf16 represents the aberrant genetic programs and drives the progression of PDAC. Bmc Cancer. 2022;22(1):1102. PubMed |