Anti C9orf16 pAb (ATL-HPA020725)

Atlas Antibodies

Catalog No.:
ATL-HPA020725-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 16
Gene Name: C9orf16
Alternative Gene Name: EST00098, FLJ12823, MGC4639
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039195: 94%, ENSRNOG00000022681: 94%
Entrez Gene ID: 79095
Uniprot ID: Q9BUW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP
Gene Sequence NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP
Gene ID - Mouse ENSMUSG00000039195
Gene ID - Rat ENSRNOG00000022681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C9orf16 pAb (ATL-HPA020725)
Datasheet Anti C9orf16 pAb (ATL-HPA020725) Datasheet (External Link)
Vendor Page Anti C9orf16 pAb (ATL-HPA020725) at Atlas Antibodies

Documents & Links for Anti C9orf16 pAb (ATL-HPA020725)
Datasheet Anti C9orf16 pAb (ATL-HPA020725) Datasheet (External Link)
Vendor Page Anti C9orf16 pAb (ATL-HPA020725)
Citations for Anti C9orf16 pAb (ATL-HPA020725) – 1 Found
Chen, Xiaojun; Zhang, Hong; Xiao, Bo. C9orf16 represents the aberrant genetic programs and drives the progression of PDAC. Bmc Cancer. 2022;22(1):1102.  PubMed