Anti C9orf153 pAb (ATL-HPA079466)

Atlas Antibodies

Catalog No.:
ATL-HPA079466-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 153
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS
Gene Sequence LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS
Gene ID - Mouse ENSMUSG00000049902
Gene ID - Rat ENSRNOG00000042206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C9orf153 pAb (ATL-HPA079466)
Datasheet Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link)
Vendor Page Anti C9orf153 pAb (ATL-HPA079466) at Atlas Antibodies

Documents & Links for Anti C9orf153 pAb (ATL-HPA079466)
Datasheet Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link)
Vendor Page Anti C9orf153 pAb (ATL-HPA079466)