Anti C9orf153 pAb (ATL-HPA079466)

Atlas Antibodies

SKU: ATL-HPA079466-25

• 

Protein Description: chromosome 9 open reading frame 153
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS
• Gene Sequence: LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS
• Gene ID - Mouse: ENSMUSG00000049902
• Gene ID - Rat: ENSRNOG00000042206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.