Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045268-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C9orf142
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047617: 78%, ENSRNOG00000015294: 79%
Entrez Gene ID: 286257
Uniprot ID: Q9BUH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET |
Gene Sequence | LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET |
Gene ID - Mouse | ENSMUSG00000047617 |
Gene ID - Rat | ENSRNOG00000015294 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) | |
Datasheet | Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) | |
Datasheet | Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) |
Citations for Anti C9orf142 pAb (ATL-HPA045268 w/enhanced validation) – 1 Found |
Craxton, Andrew; Munnur, Deeksha; Jukes-Jones, Rebekah; Skalka, George; Langlais, Claudia; Cain, Kelvin; Malewicz, Michal. PAXX and its paralogs synergistically direct DNA polymerase λ activity in DNA repair. Nature Communications. 2018;9(1):3877. PubMed |