Anti C9orf116 pAb (ATL-HPA021439)
Atlas Antibodies
- SKU:
- ATL-HPA021439-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C9orf116
Alternative Gene Name: MGC29761, PIERCE1, RbEST47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026831: 78%, ENSRNOG00000010152: 71%
Entrez Gene ID: 138162
Uniprot ID: Q5BN46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD |
Gene Sequence | PTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD |
Gene ID - Mouse | ENSMUSG00000026831 |
Gene ID - Rat | ENSRNOG00000010152 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C9orf116 pAb (ATL-HPA021439) | |
Datasheet | Anti C9orf116 pAb (ATL-HPA021439) Datasheet (External Link) |
Vendor Page | Anti C9orf116 pAb (ATL-HPA021439) at Atlas Antibodies |
Documents & Links for Anti C9orf116 pAb (ATL-HPA021439) | |
Datasheet | Anti C9orf116 pAb (ATL-HPA021439) Datasheet (External Link) |
Vendor Page | Anti C9orf116 pAb (ATL-HPA021439) |