Anti C9orf116 pAb (ATL-HPA021439)

Atlas Antibodies

Catalog No.:
ATL-HPA021439-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 9 open reading frame 116
Gene Name: C9orf116
Alternative Gene Name: MGC29761, PIERCE1, RbEST47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026831: 78%, ENSRNOG00000010152: 71%
Entrez Gene ID: 138162
Uniprot ID: Q5BN46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD
Gene Sequence PTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD
Gene ID - Mouse ENSMUSG00000026831
Gene ID - Rat ENSRNOG00000010152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C9orf116 pAb (ATL-HPA021439)
Datasheet Anti C9orf116 pAb (ATL-HPA021439) Datasheet (External Link)
Vendor Page Anti C9orf116 pAb (ATL-HPA021439) at Atlas Antibodies

Documents & Links for Anti C9orf116 pAb (ATL-HPA021439)
Datasheet Anti C9orf116 pAb (ATL-HPA021439) Datasheet (External Link)
Vendor Page Anti C9orf116 pAb (ATL-HPA021439)