Anti C9 pAb (ATL-HPA029577)

Atlas Antibodies

SKU:
ATL-HPA029577-25
  • Immunohistochemical staining of human Liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component 9
Gene Name: C9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022149: 56%, ENSRNOG00000013736: 63%
Entrez Gene ID: 735
Uniprot ID: P02748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Gene Sequence CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Gene ID - Mouse ENSMUSG00000022149
Gene ID - Rat ENSRNOG00000013736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C9 pAb (ATL-HPA029577)
Datasheet Anti C9 pAb (ATL-HPA029577) Datasheet (External Link)
Vendor Page Anti C9 pAb (ATL-HPA029577) at Atlas Antibodies

Documents & Links for Anti C9 pAb (ATL-HPA029577)
Datasheet Anti C9 pAb (ATL-HPA029577) Datasheet (External Link)
Vendor Page Anti C9 pAb (ATL-HPA029577)



Citations for Anti C9 pAb (ATL-HPA029577) – 2 Found
Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10.  PubMed
Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2)  PubMed