Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA078486-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 88
Gene Name: C8orf88
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050930: 29%, ENSRNOG00000047537: 92%
Entrez Gene ID: 100127983
Uniprot ID: P0DMB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK
Gene Sequence METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK
Gene ID - Mouse ENSMUSG00000050930
Gene ID - Rat ENSRNOG00000047537
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation)
Datasheet Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation)
Datasheet Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation)