Anti C8orf86 pAb (ATL-HPA025066)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025066-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C8orf86
Alternative Gene Name: FLJ43582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034751: 29%, ENSRNOG00000030418: 28%
Entrez Gene ID: 389649
Uniprot ID: Q6ZUL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA |
Gene Sequence | VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA |
Gene ID - Mouse | ENSMUSG00000034751 |
Gene ID - Rat | ENSRNOG00000030418 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C8orf86 pAb (ATL-HPA025066) | |
Datasheet | Anti C8orf86 pAb (ATL-HPA025066) Datasheet (External Link) |
Vendor Page | Anti C8orf86 pAb (ATL-HPA025066) at Atlas Antibodies |
Documents & Links for Anti C8orf86 pAb (ATL-HPA025066) | |
Datasheet | Anti C8orf86 pAb (ATL-HPA025066) Datasheet (External Link) |
Vendor Page | Anti C8orf86 pAb (ATL-HPA025066) |