Anti C8orf86 pAb (ATL-HPA025066)

Atlas Antibodies

Catalog No.: ATL-HPA025066-25

Protein Description: chromosome 8 open reading frame 86
Gene Name: C8orf86
Alternative Gene Name: FLJ43582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034751: 29%, ENSRNOG00000030418: 28%
Entrez Gene ID: 389649
Uniprot ID: Q6ZUL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA
• Gene Sequence: VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA
• Gene ID - Mouse: ENSMUSG00000034751
• Gene ID - Rat: ENSRNOG00000030418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.