Anti C8orf76 pAb (ATL-HPA023708)

Atlas Antibodies

SKU: ATL-HPA023708-25

• 

Protein Description: chromosome 8 open reading frame 76
Gene Name: C8orf76
Alternative Gene Name: FLJ14825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101892: 48%, ENSRNOG00000006370: 47%
Entrez Gene ID: 84933
Uniprot ID: Q96K31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQ
• Gene Sequence: PHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQ
• Gene ID - Mouse: ENSMUSG00000101892
• Gene ID - Rat: ENSRNOG00000006370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.