Anti C8orf74 pAb (ATL-HPA027986)

Atlas Antibodies

Catalog No.:
ATL-HPA027986-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 74
Gene Name: C8orf74
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021961: 56%, ENSRNOG00000012402: 56%
Entrez Gene ID: 203076
Uniprot ID: Q6P047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK
Gene Sequence CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK
Gene ID - Mouse ENSMUSG00000021961
Gene ID - Rat ENSRNOG00000012402
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf74 pAb (ATL-HPA027986)
Datasheet Anti C8orf74 pAb (ATL-HPA027986) Datasheet (External Link)
Vendor Page Anti C8orf74 pAb (ATL-HPA027986) at Atlas Antibodies

Documents & Links for Anti C8orf74 pAb (ATL-HPA027986)
Datasheet Anti C8orf74 pAb (ATL-HPA027986) Datasheet (External Link)
Vendor Page Anti C8orf74 pAb (ATL-HPA027986)