Anti C8orf74 pAb (ATL-HPA027986)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027986-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C8orf74
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021961: 56%, ENSRNOG00000012402: 56%
Entrez Gene ID: 203076
Uniprot ID: Q6P047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK |
Gene Sequence | CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK |
Gene ID - Mouse | ENSMUSG00000021961 |
Gene ID - Rat | ENSRNOG00000012402 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C8orf74 pAb (ATL-HPA027986) | |
Datasheet | Anti C8orf74 pAb (ATL-HPA027986) Datasheet (External Link) |
Vendor Page | Anti C8orf74 pAb (ATL-HPA027986) at Atlas Antibodies |
Documents & Links for Anti C8orf74 pAb (ATL-HPA027986) | |
Datasheet | Anti C8orf74 pAb (ATL-HPA027986) Datasheet (External Link) |
Vendor Page | Anti C8orf74 pAb (ATL-HPA027986) |