Anti C8orf48 pAb (ATL-HPA027440 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027440-25

• 
• 
• 

Protein Description: chromosome 8 open reading frame 48
Gene Name: C8orf48
Alternative Gene Name: FLJ25402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074384: 41%, ENSRNOG00000024693: 26%
Entrez Gene ID: 157773
Uniprot ID: Q96LL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFLTRIGEAHQDFPRLSDDPRIIWKRLTEKSHIRYSGFERSETEQKMQRDGNSACHLPFSLPFLKRLTLIKPELVIVNDNV
• Gene Sequence: DFLTRIGEAHQDFPRLSDDPRIIWKRLTEKSHIRYSGFERSETEQKMQRDGNSACHLPFSLPFLKRLTLIKPELVIVNDNV
• Gene ID - Mouse: ENSMUSG00000074384
• Gene ID - Rat: ENSRNOG00000024693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.