Anti C8orf48 pAb (ATL-HPA025068)

Atlas Antibodies

Catalog No.:
ATL-HPA025068-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 48
Gene Name: C8orf48
Alternative Gene Name: FLJ25402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074384: 54%, ENSRNOG00000047506: 26%
Entrez Gene ID: 157773
Uniprot ID: Q96LL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV
Gene Sequence KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV
Gene ID - Mouse ENSMUSG00000074384
Gene ID - Rat ENSRNOG00000047506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf48 pAb (ATL-HPA025068)
Datasheet Anti C8orf48 pAb (ATL-HPA025068) Datasheet (External Link)
Vendor Page Anti C8orf48 pAb (ATL-HPA025068) at Atlas Antibodies

Documents & Links for Anti C8orf48 pAb (ATL-HPA025068)
Datasheet Anti C8orf48 pAb (ATL-HPA025068) Datasheet (External Link)
Vendor Page Anti C8orf48 pAb (ATL-HPA025068)