Anti C8orf48 pAb (ATL-HPA025068)

Atlas Antibodies

Catalog No.: ATL-HPA025068-25

Protein Description: chromosome 8 open reading frame 48
Gene Name: C8orf48
Alternative Gene Name: FLJ25402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074384: 54%, ENSRNOG00000047506: 26%
Entrez Gene ID: 157773
Uniprot ID: Q96LL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV
• Gene Sequence: KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV
• Gene ID - Mouse: ENSMUSG00000074384
• Gene ID - Rat: ENSRNOG00000047506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.