Anti C8orf44 pAb (ATL-HPA054753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054753-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C8orf44
Alternative Gene Name: FLJ11267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109179: 38%, ENSRNOG00000046851: 32%
Entrez Gene ID: 56260
Uniprot ID: Q96CB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMP |
Gene Sequence | MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMP |
Gene ID - Mouse | ENSMUSG00000109179 |
Gene ID - Rat | ENSRNOG00000046851 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C8orf44 pAb (ATL-HPA054753) | |
Datasheet | Anti C8orf44 pAb (ATL-HPA054753) Datasheet (External Link) |
Vendor Page | Anti C8orf44 pAb (ATL-HPA054753) at Atlas Antibodies |
Documents & Links for Anti C8orf44 pAb (ATL-HPA054753) | |
Datasheet | Anti C8orf44 pAb (ATL-HPA054753) Datasheet (External Link) |
Vendor Page | Anti C8orf44 pAb (ATL-HPA054753) |