Anti C8orf44 pAb (ATL-HPA043660)

Atlas Antibodies

Catalog No.:
ATL-HPA043660-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 44
Gene Name: C8orf44
Alternative Gene Name: FLJ11267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028345: 23%, ENSRNOG00000021795: 22%
Entrez Gene ID: 56260
Uniprot ID: Q96CB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNL
Gene Sequence TKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNL
Gene ID - Mouse ENSMUSG00000028345
Gene ID - Rat ENSRNOG00000021795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf44 pAb (ATL-HPA043660)
Datasheet Anti C8orf44 pAb (ATL-HPA043660) Datasheet (External Link)
Vendor Page Anti C8orf44 pAb (ATL-HPA043660) at Atlas Antibodies

Documents & Links for Anti C8orf44 pAb (ATL-HPA043660)
Datasheet Anti C8orf44 pAb (ATL-HPA043660) Datasheet (External Link)
Vendor Page Anti C8orf44 pAb (ATL-HPA043660)