Anti C8orf44 pAb (ATL-HPA043660)

Atlas Antibodies

SKU: ATL-HPA043660-25

• 
• 

Protein Description: chromosome 8 open reading frame 44
Gene Name: C8orf44
Alternative Gene Name: FLJ11267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028345: 23%, ENSRNOG00000021795: 22%
Entrez Gene ID: 56260
Uniprot ID: Q96CB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNL
• Gene Sequence: TKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNL
• Gene ID - Mouse: ENSMUSG00000028345
• Gene ID - Rat: ENSRNOG00000021795
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.