Anti C8orf37 pAb (ATL-HPA024198)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024198-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C8orf37
Alternative Gene Name: CORD16, FLJ30600, RP64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059482: 76%, ENSRNOG00000049287: 75%
Entrez Gene ID: 157657
Uniprot ID: Q96NL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE |
| Gene Sequence | MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE |
| Gene ID - Mouse | ENSMUSG00000059482 |
| Gene ID - Rat | ENSRNOG00000049287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C8orf37 pAb (ATL-HPA024198) | |
| Datasheet | Anti C8orf37 pAb (ATL-HPA024198) Datasheet (External Link) |
| Vendor Page | Anti C8orf37 pAb (ATL-HPA024198) at Atlas Antibodies |
| Documents & Links for Anti C8orf37 pAb (ATL-HPA024198) | |
| Datasheet | Anti C8orf37 pAb (ATL-HPA024198) Datasheet (External Link) |
| Vendor Page | Anti C8orf37 pAb (ATL-HPA024198) |