Anti C8orf37 pAb (ATL-HPA024198)

Atlas Antibodies

Catalog No.: ATL-HPA024198-25

Protein Description: chromosome 8 open reading frame 37
Gene Name: C8orf37
Alternative Gene Name: CORD16, FLJ30600, RP64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059482: 76%, ENSRNOG00000049287: 75%
Entrez Gene ID: 157657
Uniprot ID: Q96NL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
• Gene Sequence: MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
• Gene ID - Mouse: ENSMUSG00000059482
• Gene ID - Rat: ENSRNOG00000049287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.