Anti C8orf37 pAb (ATL-HPA024198)

Atlas Antibodies

Catalog No.:
ATL-HPA024198-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 37
Gene Name: C8orf37
Alternative Gene Name: CORD16, FLJ30600, RP64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059482: 76%, ENSRNOG00000049287: 75%
Entrez Gene ID: 157657
Uniprot ID: Q96NL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
Gene Sequence MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
Gene ID - Mouse ENSMUSG00000059482
Gene ID - Rat ENSRNOG00000049287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf37 pAb (ATL-HPA024198)
Datasheet Anti C8orf37 pAb (ATL-HPA024198) Datasheet (External Link)
Vendor Page Anti C8orf37 pAb (ATL-HPA024198) at Atlas Antibodies

Documents & Links for Anti C8orf37 pAb (ATL-HPA024198)
Datasheet Anti C8orf37 pAb (ATL-HPA024198) Datasheet (External Link)
Vendor Page Anti C8orf37 pAb (ATL-HPA024198)