Anti C8orf34 pAb (ATL-HPA044420)

Atlas Antibodies

Catalog No.: ATL-HPA044420-25

Protein Description: chromosome 8 open reading frame 34
Gene Name: C8orf34
Alternative Gene Name: vest-1, VEST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057715: 81%, ENSRNOG00000005375: 82%
Entrez Gene ID: 116328
Uniprot ID: Q49A92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS
• Gene Sequence: LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS
• Gene ID - Mouse: ENSMUSG00000057715
• Gene ID - Rat: ENSRNOG00000005375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.