Anti C8orf34 pAb (ATL-HPA044420)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044420-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C8orf34
Alternative Gene Name: vest-1, VEST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057715: 81%, ENSRNOG00000005375: 82%
Entrez Gene ID: 116328
Uniprot ID: Q49A92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS |
Gene Sequence | LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS |
Gene ID - Mouse | ENSMUSG00000057715 |
Gene ID - Rat | ENSRNOG00000005375 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C8orf34 pAb (ATL-HPA044420) | |
Datasheet | Anti C8orf34 pAb (ATL-HPA044420) Datasheet (External Link) |
Vendor Page | Anti C8orf34 pAb (ATL-HPA044420) at Atlas Antibodies |
Documents & Links for Anti C8orf34 pAb (ATL-HPA044420) | |
Datasheet | Anti C8orf34 pAb (ATL-HPA044420) Datasheet (External Link) |
Vendor Page | Anti C8orf34 pAb (ATL-HPA044420) |