Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024812-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 8 open reading frame 33
Gene Name: C8orf33
Alternative Gene Name: FLJ20989
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063236: 77%, ENSRNOG00000034107: 72%
Entrez Gene ID: 65265
Uniprot ID: Q9H7E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
Gene Sequence LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
Gene ID - Mouse ENSMUSG00000063236
Gene ID - Rat ENSRNOG00000034107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation)
Datasheet Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation)
Datasheet Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation)