Anti C8orf33 pAb (ATL-HPA024812 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024812-25

Protein Description: chromosome 8 open reading frame 33
Gene Name: C8orf33
Alternative Gene Name: FLJ20989
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063236: 77%, ENSRNOG00000034107: 72%
Entrez Gene ID: 65265
Uniprot ID: Q9H7E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
• Gene Sequence: LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
• Gene ID - Mouse: ENSMUSG00000063236
• Gene ID - Rat: ENSRNOG00000034107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.