Anti C8G pAb (ATL-HPA046269)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046269-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C8G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015083: 81%, ENSRNOG00000028701: 78%
Entrez Gene ID: 733
Uniprot ID: P07360
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET |
Gene Sequence | STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET |
Gene ID - Mouse | ENSMUSG00000015083 |
Gene ID - Rat | ENSRNOG00000028701 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C8G pAb (ATL-HPA046269) | |
Datasheet | Anti C8G pAb (ATL-HPA046269) Datasheet (External Link) |
Vendor Page | Anti C8G pAb (ATL-HPA046269) at Atlas Antibodies |
Documents & Links for Anti C8G pAb (ATL-HPA046269) | |
Datasheet | Anti C8G pAb (ATL-HPA046269) Datasheet (External Link) |
Vendor Page | Anti C8G pAb (ATL-HPA046269) |
Citations for Anti C8G pAb (ATL-HPA046269) – 1 Found |
Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2) PubMed |