Anti C8B pAb (ATL-HPA023694 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023694-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: complement component 8, beta polypeptide
Gene Name: C8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029656: 78%, ENSRNOG00000007639: 78%
Entrez Gene ID: 732
Uniprot ID: P07358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Gene Sequence PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Gene ID - Mouse ENSMUSG00000029656
Gene ID - Rat ENSRNOG00000007639
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C8B pAb (ATL-HPA023694 w/enhanced validation)
Datasheet Anti C8B pAb (ATL-HPA023694 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8B pAb (ATL-HPA023694 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C8B pAb (ATL-HPA023694 w/enhanced validation)
Datasheet Anti C8B pAb (ATL-HPA023694 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C8B pAb (ATL-HPA023694 w/enhanced validation)