Anti C7orf72 pAb (ATL-HPA026094)

Atlas Antibodies

Catalog No.: ATL-HPA026094-25

Protein Description: chromosome 7 open reading frame 72
Gene Name: C7orf72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020191: 73%, ENSRNOG00000037621: 71%
Entrez Gene ID: 100130988
Uniprot ID: A4D263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVFQKEMAVDLFRHQAPLSRLVTTVRPYNPFNKKDKETIDY
• Gene Sequence: ANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVFQKEMAVDLFRHQAPLSRLVTTVRPYNPFNKKDKETIDY
• Gene ID - Mouse: ENSMUSG00000020191
• Gene ID - Rat: ENSRNOG00000037621
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.