Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA021286-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 7 open reading frame 57
Gene Name: C7orf57
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040978: 59%, ENSRNOG00000037632: 57%
Entrez Gene ID: 136288
Uniprot ID: Q8NEG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
Gene Sequence ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
Gene ID - Mouse ENSMUSG00000040978
Gene ID - Rat ENSRNOG00000037632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation)
Datasheet Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation)
Datasheet Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation)