Anti C7orf57 pAb (ATL-HPA021286 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021286-25

Protein Description: chromosome 7 open reading frame 57
Gene Name: C7orf57
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040978: 59%, ENSRNOG00000037632: 57%
Entrez Gene ID: 136288
Uniprot ID: Q8NEG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
• Gene Sequence: ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
• Gene ID - Mouse: ENSMUSG00000040978
• Gene ID - Rat: ENSRNOG00000037632
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.