Anti C7orf50 pAb (ATL-HPA052281)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052281-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C7orf50
Alternative Gene Name: MGC11257, YCR016W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053553: 67%, ENSRNOG00000001289: 66%
Entrez Gene ID: 84310
Uniprot ID: Q9BRJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYD |
| Gene Sequence | KERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYD |
| Gene ID - Mouse | ENSMUSG00000053553 |
| Gene ID - Rat | ENSRNOG00000001289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C7orf50 pAb (ATL-HPA052281) | |
| Datasheet | Anti C7orf50 pAb (ATL-HPA052281) Datasheet (External Link) |
| Vendor Page | Anti C7orf50 pAb (ATL-HPA052281) at Atlas Antibodies |
| Documents & Links for Anti C7orf50 pAb (ATL-HPA052281) | |
| Datasheet | Anti C7orf50 pAb (ATL-HPA052281) Datasheet (External Link) |
| Vendor Page | Anti C7orf50 pAb (ATL-HPA052281) |
| Citations for Anti C7orf50 pAb (ATL-HPA052281) – 1 Found |
| Mund, Andreas; Coscia, Fabian; Kriston, András; Hollandi, Réka; Kovács, Ferenc; Brunner, Andreas-David; Migh, Ede; Schweizer, Lisa; Santos, Alberto; Bzorek, Michael; Naimy, Soraya; Rahbek-Gjerdrum, Lise Mette; Dyring-Andersen, Beatrice; Bulkescher, Jutta; Lukas, Claudia; Eckert, Mark Adam; Lengyel, Ernst; Gnann, Christian; Lundberg, Emma; Horvath, Peter; Mann, Matthias. Deep Visual Proteomics defines single-cell identity and heterogeneity. Nature Biotechnology. 2022;40(8):1231-1240. PubMed |