Anti C7orf50 pAb (ATL-HPA052281)

Atlas Antibodies

Catalog No.: ATL-HPA052281-25

Protein Description: chromosome 7 open reading frame 50
Gene Name: C7orf50
Alternative Gene Name: MGC11257, YCR016W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053553: 67%, ENSRNOG00000001289: 66%
Entrez Gene ID: 84310
Uniprot ID: Q9BRJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYD
• Gene Sequence: KERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYD
• Gene ID - Mouse: ENSMUSG00000053553
• Gene ID - Rat: ENSRNOG00000001289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C7orf50 pAb (ATL-HPA052281) – 1 Found

Mund, Andreas; Coscia, Fabian; Kriston, András; Hollandi, Réka; Kovács, Ferenc; Brunner, Andreas-David; Migh, Ede; Schweizer, Lisa; Santos, Alberto; Bzorek, Michael; Naimy, Soraya; Rahbek-Gjerdrum, Lise Mette; Dyring-Andersen, Beatrice; Bulkescher, Jutta; Lukas, Claudia; Eckert, Mark Adam; Lengyel, Ernst; Gnann, Christian; Lundberg, Emma; Horvath, Peter; Mann, Matthias. Deep Visual Proteomics defines single-cell identity and heterogeneity. Nature Biotechnology. 2022;40(8):1231-1240.