Anti C7orf43 pAb (ATL-HPA029464)

Atlas Antibodies

SKU:
ATL-HPA029464-25
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 7 open reading frame 43
Gene Name: C7orf43
Alternative Gene Name: FLJ10925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036948: 98%, ENSRNOG00000039214: 98%
Entrez Gene ID: 55262
Uniprot ID: Q8WVR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEVPLIAVVQWSTPKLPFTQSIYTHYRLPSVRLDRPCFVMTASCKSPVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEEERRAMQAALDSVVCHTPLNNLGFSRKGS
Gene Sequence LEVPLIAVVQWSTPKLPFTQSIYTHYRLPSVRLDRPCFVMTASCKSPVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEEERRAMQAALDSVVCHTPLNNLGFSRKGS
Gene ID - Mouse ENSMUSG00000036948
Gene ID - Rat ENSRNOG00000039214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C7orf43 pAb (ATL-HPA029464)
Datasheet Anti C7orf43 pAb (ATL-HPA029464) Datasheet (External Link)
Vendor Page Anti C7orf43 pAb (ATL-HPA029464) at Atlas Antibodies

Documents & Links for Anti C7orf43 pAb (ATL-HPA029464)
Datasheet Anti C7orf43 pAb (ATL-HPA029464) Datasheet (External Link)
Vendor Page Anti C7orf43 pAb (ATL-HPA029464)