Anti C7orf43 pAb (ATL-HPA029463)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029463-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C7orf43
Alternative Gene Name: FLJ10925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036948: 97%, ENSRNOG00000039214: 97%
Entrez Gene ID: 55262
Uniprot ID: Q8WVR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGCFPCPLNALE |
Gene Sequence | ETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGCFPCPLNALE |
Gene ID - Mouse | ENSMUSG00000036948 |
Gene ID - Rat | ENSRNOG00000039214 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C7orf43 pAb (ATL-HPA029463) | |
Datasheet | Anti C7orf43 pAb (ATL-HPA029463) Datasheet (External Link) |
Vendor Page | Anti C7orf43 pAb (ATL-HPA029463) at Atlas Antibodies |
Documents & Links for Anti C7orf43 pAb (ATL-HPA029463) | |
Datasheet | Anti C7orf43 pAb (ATL-HPA029463) Datasheet (External Link) |
Vendor Page | Anti C7orf43 pAb (ATL-HPA029463) |
Citations for Anti C7orf43 pAb (ATL-HPA029463) – 1 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |