Anti C7orf43 pAb (ATL-HPA029463)

Atlas Antibodies

Catalog No.: ATL-HPA029463-25

Protein Description: chromosome 7 open reading frame 43
Gene Name: C7orf43
Alternative Gene Name: FLJ10925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036948: 97%, ENSRNOG00000039214: 97%
Entrez Gene ID: 55262
Uniprot ID: Q8WVR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGCFPCPLNALE
• Gene Sequence: ETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGCFPCPLNALE
• Gene ID - Mouse: ENSMUSG00000036948
• Gene ID - Rat: ENSRNOG00000039214
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C7orf43 pAb (ATL-HPA029463) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.