Anti C7orf43 pAb (ATL-HPA019359)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019359-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: C7orf43
Alternative Gene Name: FLJ10925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036948: 100%, ENSRNOG00000039214: 100%
Entrez Gene ID: 55262
Uniprot ID: Q8WVR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE |
| Gene Sequence | LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE |
| Gene ID - Mouse | ENSMUSG00000036948 |
| Gene ID - Rat | ENSRNOG00000039214 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C7orf43 pAb (ATL-HPA019359) | |
| Datasheet | Anti C7orf43 pAb (ATL-HPA019359) Datasheet (External Link) |
| Vendor Page | Anti C7orf43 pAb (ATL-HPA019359) at Atlas Antibodies |
| Documents & Links for Anti C7orf43 pAb (ATL-HPA019359) | |
| Datasheet | Anti C7orf43 pAb (ATL-HPA019359) Datasheet (External Link) |
| Vendor Page | Anti C7orf43 pAb (ATL-HPA019359) |
| Citations for Anti C7orf43 pAb (ATL-HPA019359) – 1 Found |
| Perez, Yonatan; Bar-Yaacov, Reut; Kadir, Rotem; Wormser, Ohad; Shelef, Ilan; Birk, Ohad S; Flusser, Hagit; Birnbaum, Ramon Y. Mutations in the microtubule-associated protein MAP11 (C7orf43) cause microcephaly in humans and zebrafish. Brain : A Journal Of Neurology. 2019;142(3):574-585. PubMed |