Anti C7orf43 pAb (ATL-HPA019359)

Atlas Antibodies

Catalog No.:
ATL-HPA019359-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 7 open reading frame 43
Gene Name: C7orf43
Alternative Gene Name: FLJ10925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036948: 100%, ENSRNOG00000039214: 100%
Entrez Gene ID: 55262
Uniprot ID: Q8WVR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE
Gene Sequence LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE
Gene ID - Mouse ENSMUSG00000036948
Gene ID - Rat ENSRNOG00000039214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C7orf43 pAb (ATL-HPA019359)
Datasheet Anti C7orf43 pAb (ATL-HPA019359) Datasheet (External Link)
Vendor Page Anti C7orf43 pAb (ATL-HPA019359) at Atlas Antibodies

Documents & Links for Anti C7orf43 pAb (ATL-HPA019359)
Datasheet Anti C7orf43 pAb (ATL-HPA019359) Datasheet (External Link)
Vendor Page Anti C7orf43 pAb (ATL-HPA019359)
Citations for Anti C7orf43 pAb (ATL-HPA019359) – 1 Found
Perez, Yonatan; Bar-Yaacov, Reut; Kadir, Rotem; Wormser, Ohad; Shelef, Ilan; Birk, Ohad S; Flusser, Hagit; Birnbaum, Ramon Y. Mutations in the microtubule-associated protein MAP11 (C7orf43) cause microcephaly in humans and zebrafish. Brain : A Journal Of Neurology. 2019;142(3):574-585.  PubMed