Anti C7orf25 pAb (ATL-HPA049635)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049635-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: C7orf25
Alternative Gene Name: MGC2821
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039182: 92%, ENSRNOG00000015523: 92%
Entrez Gene ID: 79020
Uniprot ID: Q9BPX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF |
| Gene Sequence | RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF |
| Gene ID - Mouse | ENSMUSG00000039182 |
| Gene ID - Rat | ENSRNOG00000015523 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C7orf25 pAb (ATL-HPA049635) | |
| Datasheet | Anti C7orf25 pAb (ATL-HPA049635) Datasheet (External Link) |
| Vendor Page | Anti C7orf25 pAb (ATL-HPA049635) at Atlas Antibodies |
| Documents & Links for Anti C7orf25 pAb (ATL-HPA049635) | |
| Datasheet | Anti C7orf25 pAb (ATL-HPA049635) Datasheet (External Link) |
| Vendor Page | Anti C7orf25 pAb (ATL-HPA049635) |