Anti C7orf25 pAb (ATL-HPA049635)

Atlas Antibodies

Catalog No.:
ATL-HPA049635-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 7 open reading frame 25
Gene Name: C7orf25
Alternative Gene Name: MGC2821
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039182: 92%, ENSRNOG00000015523: 92%
Entrez Gene ID: 79020
Uniprot ID: Q9BPX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF
Gene Sequence RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF
Gene ID - Mouse ENSMUSG00000039182
Gene ID - Rat ENSRNOG00000015523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C7orf25 pAb (ATL-HPA049635)
Datasheet Anti C7orf25 pAb (ATL-HPA049635) Datasheet (External Link)
Vendor Page Anti C7orf25 pAb (ATL-HPA049635) at Atlas Antibodies

Documents & Links for Anti C7orf25 pAb (ATL-HPA049635)
Datasheet Anti C7orf25 pAb (ATL-HPA049635) Datasheet (External Link)
Vendor Page Anti C7orf25 pAb (ATL-HPA049635)