Anti C7orf25 pAb (ATL-HPA049635)

Atlas Antibodies

SKU: ATL-HPA049635-100

• 
• 

Protein Description: chromosome 7 open reading frame 25
Gene Name: C7orf25
Alternative Gene Name: MGC2821
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039182: 92%, ENSRNOG00000015523: 92%
Entrez Gene ID: 79020
Uniprot ID: Q9BPX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF
• Gene Sequence: RVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDF
• Gene ID - Mouse: ENSMUSG00000039182
• Gene ID - Rat: ENSRNOG00000015523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.