Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030564-100

• 
• 

Protein Description: chromosome 6 open reading frame 62
Gene Name: C6orf62
Alternative Gene Name: DKFZP564G182, FLJ12619, XTP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019132: 100%, ENSRNOG00000018456: 100%
Entrez Gene ID: 81688
Uniprot ID: Q9GZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
• Gene Sequence: NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
• Gene ID - Mouse: ENSMUSG00000019132
• Gene ID - Rat: ENSRNOG00000018456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.