Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030564-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: C6orf62
Alternative Gene Name: DKFZP564G182, FLJ12619, XTP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019132: 100%, ENSRNOG00000018456: 100%
Entrez Gene ID: 81688
Uniprot ID: Q9GZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS |
Gene Sequence | NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS |
Gene ID - Mouse | ENSMUSG00000019132 |
Gene ID - Rat | ENSRNOG00000018456 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) | |
Datasheet | Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) | |
Datasheet | Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C6orf62 pAb (ATL-HPA030564 w/enhanced validation) |