Anti C6orf52 pAb (ATL-HPA051142)

Atlas Antibodies

Catalog No.: ATL-HPA051142-25

Protein Description: chromosome 6 open reading frame 52
Gene Name: C6orf52
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028898: 39%, ENSRNOG00000039379: 64%
Entrez Gene ID: 347744
Uniprot ID: Q5T4I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHW
• Gene Sequence: HETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHW
• Gene ID - Mouse: ENSMUSG00000028898
• Gene ID - Rat: ENSRNOG00000039379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.