Anti C6orf47 pAb (ATL-HPA053373)

Atlas Antibodies

SKU:
ATL-HPA053373-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 47
Gene Name: C6orf47
Alternative Gene Name: D6S53E, G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043311: 76%, ENSRNOG00000039658: 75%
Entrez Gene ID: 57827
Uniprot ID: O95873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG
Gene Sequence MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG
Gene ID - Mouse ENSMUSG00000043311
Gene ID - Rat ENSRNOG00000039658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C6orf47 pAb (ATL-HPA053373)
Datasheet Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link)
Vendor Page Anti C6orf47 pAb (ATL-HPA053373) at Atlas Antibodies

Documents & Links for Anti C6orf47 pAb (ATL-HPA053373)
Datasheet Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link)
Vendor Page Anti C6orf47 pAb (ATL-HPA053373)