Anti C6orf47 pAb (ATL-HPA053373)
Atlas Antibodies
- SKU:
- ATL-HPA053373-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C6orf47
Alternative Gene Name: D6S53E, G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043311: 76%, ENSRNOG00000039658: 75%
Entrez Gene ID: 57827
Uniprot ID: O95873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG |
Gene Sequence | MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG |
Gene ID - Mouse | ENSMUSG00000043311 |
Gene ID - Rat | ENSRNOG00000039658 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C6orf47 pAb (ATL-HPA053373) | |
Datasheet | Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link) |
Vendor Page | Anti C6orf47 pAb (ATL-HPA053373) at Atlas Antibodies |
Documents & Links for Anti C6orf47 pAb (ATL-HPA053373) | |
Datasheet | Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link) |
Vendor Page | Anti C6orf47 pAb (ATL-HPA053373) |