Anti C6orf47 pAb (ATL-HPA053373)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053373-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C6orf47
Alternative Gene Name: D6S53E, G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043311: 76%, ENSRNOG00000039658: 75%
Entrez Gene ID: 57827
Uniprot ID: O95873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG |
| Gene Sequence | MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSG |
| Gene ID - Mouse | ENSMUSG00000043311 |
| Gene ID - Rat | ENSRNOG00000039658 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C6orf47 pAb (ATL-HPA053373) | |
| Datasheet | Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link) |
| Vendor Page | Anti C6orf47 pAb (ATL-HPA053373) at Atlas Antibodies |
| Documents & Links for Anti C6orf47 pAb (ATL-HPA053373) | |
| Datasheet | Anti C6orf47 pAb (ATL-HPA053373) Datasheet (External Link) |
| Vendor Page | Anti C6orf47 pAb (ATL-HPA053373) |