Anti C6orf223 pAb (ATL-HPA035765)

Atlas Antibodies

Catalog No.:
ATL-HPA035765-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 223
Gene Name: C6orf223
Alternative Gene Name: MGC45491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000013642: 28%
Entrez Gene ID: 221416
Uniprot ID: Q8N319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
Gene Sequence MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
Gene ID - Mouse ENSMUSG00000006403
Gene ID - Rat ENSRNOG00000013642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C6orf223 pAb (ATL-HPA035765)
Datasheet Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link)
Vendor Page Anti C6orf223 pAb (ATL-HPA035765) at Atlas Antibodies

Documents & Links for Anti C6orf223 pAb (ATL-HPA035765)
Datasheet Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link)
Vendor Page Anti C6orf223 pAb (ATL-HPA035765)