Anti C6orf223 pAb (ATL-HPA035765)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035765-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C6orf223
Alternative Gene Name: MGC45491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000013642: 28%
Entrez Gene ID: 221416
Uniprot ID: Q8N319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE |
Gene Sequence | MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE |
Gene ID - Mouse | ENSMUSG00000006403 |
Gene ID - Rat | ENSRNOG00000013642 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C6orf223 pAb (ATL-HPA035765) | |
Datasheet | Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link) |
Vendor Page | Anti C6orf223 pAb (ATL-HPA035765) at Atlas Antibodies |
Documents & Links for Anti C6orf223 pAb (ATL-HPA035765) | |
Datasheet | Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link) |
Vendor Page | Anti C6orf223 pAb (ATL-HPA035765) |