Anti C6orf223 pAb (ATL-HPA035765)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035765-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C6orf223
Alternative Gene Name: MGC45491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000013642: 28%
Entrez Gene ID: 221416
Uniprot ID: Q8N319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE |
| Gene Sequence | MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE |
| Gene ID - Mouse | ENSMUSG00000006403 |
| Gene ID - Rat | ENSRNOG00000013642 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C6orf223 pAb (ATL-HPA035765) | |
| Datasheet | Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link) |
| Vendor Page | Anti C6orf223 pAb (ATL-HPA035765) at Atlas Antibodies |
| Documents & Links for Anti C6orf223 pAb (ATL-HPA035765) | |
| Datasheet | Anti C6orf223 pAb (ATL-HPA035765) Datasheet (External Link) |
| Vendor Page | Anti C6orf223 pAb (ATL-HPA035765) |