Anti C6orf222 pAb (ATL-HPA058189)

Atlas Antibodies

Catalog No.:
ATL-HPA058189-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 222
Gene Name: C6orf222
Alternative Gene Name: DKFZp779B1540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048905: 56%, ENSRNOG00000048914: 25%
Entrez Gene ID: 389384
Uniprot ID: P0C671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM
Gene Sequence SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM
Gene ID - Mouse ENSMUSG00000048905
Gene ID - Rat ENSRNOG00000048914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C6orf222 pAb (ATL-HPA058189)
Datasheet Anti C6orf222 pAb (ATL-HPA058189) Datasheet (External Link)
Vendor Page Anti C6orf222 pAb (ATL-HPA058189) at Atlas Antibodies

Documents & Links for Anti C6orf222 pAb (ATL-HPA058189)
Datasheet Anti C6orf222 pAb (ATL-HPA058189) Datasheet (External Link)
Vendor Page Anti C6orf222 pAb (ATL-HPA058189)