Anti C6orf222 pAb (ATL-HPA058189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058189-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C6orf222
Alternative Gene Name: DKFZp779B1540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048905: 56%, ENSRNOG00000048914: 25%
Entrez Gene ID: 389384
Uniprot ID: P0C671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM |
| Gene Sequence | SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAM |
| Gene ID - Mouse | ENSMUSG00000048905 |
| Gene ID - Rat | ENSRNOG00000048914 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C6orf222 pAb (ATL-HPA058189) | |
| Datasheet | Anti C6orf222 pAb (ATL-HPA058189) Datasheet (External Link) |
| Vendor Page | Anti C6orf222 pAb (ATL-HPA058189) at Atlas Antibodies |
| Documents & Links for Anti C6orf222 pAb (ATL-HPA058189) | |
| Datasheet | Anti C6orf222 pAb (ATL-HPA058189) Datasheet (External Link) |
| Vendor Page | Anti C6orf222 pAb (ATL-HPA058189) |