Anti C6orf203 pAb (ATL-HPA049535)

Atlas Antibodies

Catalog No.: ATL-HPA049535-25

Protein Description: chromosome 6 open reading frame 203
Gene Name: C6orf203
Alternative Gene Name: HSPC230, PRED31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019797: 78%, ENSRNOG00000047118: 78%
Entrez Gene ID: 51250
Uniprot ID: Q9P0P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
• Gene Sequence: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
• Gene ID - Mouse: ENSMUSG00000019797
• Gene ID - Rat: ENSRNOG00000047118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C6orf203 pAb (ATL-HPA049535) – 1 Found

Ng, Kah Ying; Lutfullahoglu Bal, Guleycan; Richter, Uwe; Safronov, Omid; Paulin, Lars; Dunn, Cory D; Paavilainen, Ville O; Richer, Julie; Newman, William G; Taylor, Robert W; Battersby, Brendan J. Nonstop mRNAs generate a ground state of mitochondrial gene expression noise. Science Advances. 2022;8(46):eabq5234.