Anti C6orf132 pAb (ATL-HPA044588 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044588-25

• 
• 

Protein Description: chromosome 6 open reading frame 132
Gene Name: C6orf132
Alternative Gene Name: bA7K24.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034382: 88%, ENSRNOG00000015297: 90%
Entrez Gene ID: 647024
Uniprot ID: Q5T0Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGTFSKLFGKKHTTTPSTSLYATNPPWIFTQEAPEEGTGGFDGIYYGDNRFNTVSESGTATLKARPRVRPLLTFLPLNAQEN
• Gene Sequence: QGTFSKLFGKKHTTTPSTSLYATNPPWIFTQEAPEEGTGGFDGIYYGDNRFNTVSESGTATLKARPRVRPLLTFLPLNAQEN
• Gene ID - Mouse: ENSMUSG00000034382
• Gene ID - Rat: ENSRNOG00000015297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.