Anti C6orf106 pAb (ATL-HPA034490 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034490-100
  • Immunohistochemical staining of human small intestine shows membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C6orf106 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411330).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 106
Gene Name: C6orf106
Alternative Gene Name: dJ391O22.4, FLJ22195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056692: 99%, ENSRNOG00000038883: 99%
Entrez Gene ID: 64771
Uniprot ID: Q9H6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSR
Gene Sequence DVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSR
Gene ID - Mouse ENSMUSG00000056692
Gene ID - Rat ENSRNOG00000038883
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C6orf106 pAb (ATL-HPA034490 w/enhanced validation)
Datasheet Anti C6orf106 pAb (ATL-HPA034490 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C6orf106 pAb (ATL-HPA034490 w/enhanced validation)