Anti C6orf1 pAb (ATL-HPA037660)

Atlas Antibodies

Catalog No.: ATL-HPA037660-25

Protein Description: chromosome 6 open reading frame 1
Gene Name: C6orf1
Alternative Gene Name: LBH, MGC57858
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032089: 26%, ENSRNOG00000054374: 34%
Entrez Gene ID: 221491
Uniprot ID: Q86T20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP
• Gene Sequence: LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP
• Gene ID - Mouse: ENSMUSG00000032089
• Gene ID - Rat: ENSRNOG00000054374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.