Anti C6orf1 pAb (ATL-HPA037660)

Atlas Antibodies

Catalog No.:
ATL-HPA037660-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 6 open reading frame 1
Gene Name: C6orf1
Alternative Gene Name: LBH, MGC57858
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032089: 26%, ENSRNOG00000054374: 34%
Entrez Gene ID: 221491
Uniprot ID: Q86T20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP
Gene Sequence LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP
Gene ID - Mouse ENSMUSG00000032089
Gene ID - Rat ENSRNOG00000054374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C6orf1 pAb (ATL-HPA037660)
Datasheet Anti C6orf1 pAb (ATL-HPA037660) Datasheet (External Link)
Vendor Page Anti C6orf1 pAb (ATL-HPA037660) at Atlas Antibodies

Documents & Links for Anti C6orf1 pAb (ATL-HPA037660)
Datasheet Anti C6orf1 pAb (ATL-HPA037660) Datasheet (External Link)
Vendor Page Anti C6orf1 pAb (ATL-HPA037660)