Anti C6 pAb (ATL-HPA043823)

Atlas Antibodies

Catalog No.:
ATL-HPA043823-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: complement component 6
Gene Name: C6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022181: 66%, ENSRNOG00000024115: 74%
Entrez Gene ID: 729
Uniprot ID: P13671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
Gene Sequence GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
Gene ID - Mouse ENSMUSG00000022181
Gene ID - Rat ENSRNOG00000024115
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C6 pAb (ATL-HPA043823)
Datasheet Anti C6 pAb (ATL-HPA043823) Datasheet (External Link)
Vendor Page Anti C6 pAb (ATL-HPA043823) at Atlas Antibodies

Documents & Links for Anti C6 pAb (ATL-HPA043823)
Datasheet Anti C6 pAb (ATL-HPA043823) Datasheet (External Link)
Vendor Page Anti C6 pAb (ATL-HPA043823)