Anti C6 pAb (ATL-HPA043823)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043823-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022181: 66%, ENSRNOG00000024115: 74%
Entrez Gene ID: 729
Uniprot ID: P13671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA |
| Gene Sequence | GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA |
| Gene ID - Mouse | ENSMUSG00000022181 |
| Gene ID - Rat | ENSRNOG00000024115 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C6 pAb (ATL-HPA043823) | |
| Datasheet | Anti C6 pAb (ATL-HPA043823) Datasheet (External Link) |
| Vendor Page | Anti C6 pAb (ATL-HPA043823) at Atlas Antibodies |
| Documents & Links for Anti C6 pAb (ATL-HPA043823) | |
| Datasheet | Anti C6 pAb (ATL-HPA043823) Datasheet (External Link) |
| Vendor Page | Anti C6 pAb (ATL-HPA043823) |