Anti C5orf63 pAb (ATL-HPA043240)

Atlas Antibodies

Catalog No.:
ATL-HPA043240-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 5 open reading frame 63
Gene Name: C5orf63
Alternative Gene Name: FLJ44606, YDR286C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024592: 92%, ENSRNOG00000013738: 92%
Entrez Gene ID: 401207
Uniprot ID: A6NC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPVLTLFTKDPCPLCDEAKEVLKPYENRFILQEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSK
Gene Sequence LPVLTLFTKDPCPLCDEAKEVLKPYENRFILQEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSK
Gene ID - Mouse ENSMUSG00000024592
Gene ID - Rat ENSRNOG00000013738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C5orf63 pAb (ATL-HPA043240)
Datasheet Anti C5orf63 pAb (ATL-HPA043240) Datasheet (External Link)
Vendor Page Anti C5orf63 pAb (ATL-HPA043240) at Atlas Antibodies

Documents & Links for Anti C5orf63 pAb (ATL-HPA043240)
Datasheet Anti C5orf63 pAb (ATL-HPA043240) Datasheet (External Link)
Vendor Page Anti C5orf63 pAb (ATL-HPA043240)