Anti C5orf63 pAb (ATL-HPA043240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043240-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C5orf63
Alternative Gene Name: FLJ44606, YDR286C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024592: 92%, ENSRNOG00000013738: 92%
Entrez Gene ID: 401207
Uniprot ID: A6NC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPVLTLFTKDPCPLCDEAKEVLKPYENRFILQEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSK |
Gene Sequence | LPVLTLFTKDPCPLCDEAKEVLKPYENRFILQEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSK |
Gene ID - Mouse | ENSMUSG00000024592 |
Gene ID - Rat | ENSRNOG00000013738 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C5orf63 pAb (ATL-HPA043240) | |
Datasheet | Anti C5orf63 pAb (ATL-HPA043240) Datasheet (External Link) |
Vendor Page | Anti C5orf63 pAb (ATL-HPA043240) at Atlas Antibodies |
Documents & Links for Anti C5orf63 pAb (ATL-HPA043240) | |
Datasheet | Anti C5orf63 pAb (ATL-HPA043240) Datasheet (External Link) |
Vendor Page | Anti C5orf63 pAb (ATL-HPA043240) |