Anti C5orf51 pAb (ATL-HPA063816)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063816-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C5orf51
Alternative Gene Name: LOC285636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041935: 99%, ENSRNOG00000052775: 98%
Entrez Gene ID: 285636
Uniprot ID: A6NDU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED |
Gene Sequence | VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED |
Gene ID - Mouse | ENSMUSG00000041935 |
Gene ID - Rat | ENSRNOG00000052775 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C5orf51 pAb (ATL-HPA063816) | |
Datasheet | Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link) |
Vendor Page | Anti C5orf51 pAb (ATL-HPA063816) at Atlas Antibodies |
Documents & Links for Anti C5orf51 pAb (ATL-HPA063816) | |
Datasheet | Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link) |
Vendor Page | Anti C5orf51 pAb (ATL-HPA063816) |