Anti C5orf51 pAb (ATL-HPA063816)

Atlas Antibodies

SKU:
ATL-HPA063816-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 5 open reading frame 51
Gene Name: C5orf51
Alternative Gene Name: LOC285636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041935: 99%, ENSRNOG00000052775: 98%
Entrez Gene ID: 285636
Uniprot ID: A6NDU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED
Gene Sequence VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED
Gene ID - Mouse ENSMUSG00000041935
Gene ID - Rat ENSRNOG00000052775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C5orf51 pAb (ATL-HPA063816)
Datasheet Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link)
Vendor Page Anti C5orf51 pAb (ATL-HPA063816) at Atlas Antibodies

Documents & Links for Anti C5orf51 pAb (ATL-HPA063816)
Datasheet Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link)
Vendor Page Anti C5orf51 pAb (ATL-HPA063816)