Anti C5orf42 pAb (ATL-HPA036776)

Atlas Antibodies

SKU: ATL-HPA036776-25

• 
• 

Protein Description: chromosome 5 open reading frame 42
Gene Name: C5orf42
Alternative Gene Name: FLJ13231, JBTS17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039801: 53%, ENSRNOG00000042118: 56%
Entrez Gene ID: 65250
Uniprot ID: Q9H799
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LREHELNSLLFDVHTTLKRHQSKTKSQNVFRAGSCFVVAPESYESEKSSSLNDEYGMHLENQKLSSSVLVNQGIKPFLQYPSNEVNKNEGMSGLFG
• Gene Sequence: LREHELNSLLFDVHTTLKRHQSKTKSQNVFRAGSCFVVAPESYESEKSSSLNDEYGMHLENQKLSSSVLVNQGIKPFLQYPSNEVNKNEGMSGLFG
• Gene ID - Mouse: ENSMUSG00000039801
• Gene ID - Rat: ENSRNOG00000042118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.