Anti C5orf30 pAb (ATL-HPA043434)

Atlas Antibodies

SKU: ATL-HPA043434-25

• 
• 

Protein Description: chromosome 5 open reading frame 30
Gene Name: C5orf30
Alternative Gene Name: FLJ25291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044768: 94%, ENSRNOG00000032398: 91%
Entrez Gene ID: 90355
Uniprot ID: Q96GV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKC
• Gene Sequence: MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKC
• Gene ID - Mouse: ENSMUSG00000044768
• Gene ID - Rat: ENSRNOG00000032398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.