Anti C5orf15 pAb (ATL-HPA039165)

Atlas Antibodies

Catalog No.: ATL-HPA039165-25

Protein Description: chromosome 5 open reading frame 15
Gene Name: C5orf15
Alternative Gene Name: HTGN29, KCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036275: 55%, ENSRNOG00000006148: 55%
Entrez Gene ID: 56951
Uniprot ID: Q8NC54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED
• Gene Sequence: IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED
• Gene ID - Mouse: ENSMUSG00000036275
• Gene ID - Rat: ENSRNOG00000006148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.