Anti C5orf15 pAb (ATL-HPA039165)

Atlas Antibodies

Catalog No.:
ATL-HPA039165-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 5 open reading frame 15
Gene Name: C5orf15
Alternative Gene Name: HTGN29, KCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036275: 55%, ENSRNOG00000006148: 55%
Entrez Gene ID: 56951
Uniprot ID: Q8NC54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED
Gene Sequence IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED
Gene ID - Mouse ENSMUSG00000036275
Gene ID - Rat ENSRNOG00000006148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C5orf15 pAb (ATL-HPA039165)
Datasheet Anti C5orf15 pAb (ATL-HPA039165) Datasheet (External Link)
Vendor Page Anti C5orf15 pAb (ATL-HPA039165) at Atlas Antibodies

Documents & Links for Anti C5orf15 pAb (ATL-HPA039165)
Datasheet Anti C5orf15 pAb (ATL-HPA039165) Datasheet (External Link)
Vendor Page Anti C5orf15 pAb (ATL-HPA039165)