Anti C5AR1 pAb (ATL-HPA014520)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014520-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C5AR1
Alternative Gene Name: C5A, C5AR, C5R1, CD88
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049130: 63%, ENSRNOG00000047800: 72%
Entrez Gene ID: 728
Uniprot ID: P21730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV |
| Gene Sequence | QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV |
| Gene ID - Mouse | ENSMUSG00000049130 |
| Gene ID - Rat | ENSRNOG00000047800 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C5AR1 pAb (ATL-HPA014520) | |
| Datasheet | Anti C5AR1 pAb (ATL-HPA014520) Datasheet (External Link) |
| Vendor Page | Anti C5AR1 pAb (ATL-HPA014520) at Atlas Antibodies |
| Documents & Links for Anti C5AR1 pAb (ATL-HPA014520) | |
| Datasheet | Anti C5AR1 pAb (ATL-HPA014520) Datasheet (External Link) |
| Vendor Page | Anti C5AR1 pAb (ATL-HPA014520) |