Anti C5AR1 pAb (ATL-HPA014520)

Atlas Antibodies

Catalog No.:
ATL-HPA014520-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: complement component 5a receptor 1
Gene Name: C5AR1
Alternative Gene Name: C5A, C5AR, C5R1, CD88
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049130: 63%, ENSRNOG00000047800: 72%
Entrez Gene ID: 728
Uniprot ID: P21730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Gene Sequence QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Gene ID - Mouse ENSMUSG00000049130
Gene ID - Rat ENSRNOG00000047800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C5AR1 pAb (ATL-HPA014520)
Datasheet Anti C5AR1 pAb (ATL-HPA014520) Datasheet (External Link)
Vendor Page Anti C5AR1 pAb (ATL-HPA014520) at Atlas Antibodies

Documents & Links for Anti C5AR1 pAb (ATL-HPA014520)
Datasheet Anti C5AR1 pAb (ATL-HPA014520) Datasheet (External Link)
Vendor Page Anti C5AR1 pAb (ATL-HPA014520)