Anti C4orf48 pAb (ATL-HPA052447)

Atlas Antibodies

Catalog No.: ATL-HPA052447-25

Protein Description: chromosome 4 open reading frame 48
Gene Name: C4orf48
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070858: 98%, ENSRNOG00000038150: 98%
Entrez Gene ID: 401115
Uniprot ID: Q5BLP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWP
• Gene Sequence: QSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWP
• Gene ID - Mouse: ENSMUSG00000070858
• Gene ID - Rat: ENSRNOG00000038150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.