Anti C4orf47 pAb (ATL-HPA043662)

Atlas Antibodies

Catalog No.: ATL-HPA043662-25

Protein Description: chromosome 4 open reading frame 47
Gene Name: C4orf47
Alternative Gene Name: LOC441054
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071103: 80%, ENSRNOG00000038819: 81%
Entrez Gene ID: 441054
Uniprot ID: A7E2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN
• Gene Sequence: ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN
• Gene ID - Mouse: ENSMUSG00000071103
• Gene ID - Rat: ENSRNOG00000038819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.