Anti C4orf47 pAb (ATL-HPA043662)

Atlas Antibodies

Catalog No.:
ATL-HPA043662-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 47
Gene Name: C4orf47
Alternative Gene Name: LOC441054
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071103: 80%, ENSRNOG00000038819: 81%
Entrez Gene ID: 441054
Uniprot ID: A7E2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN
Gene Sequence ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN
Gene ID - Mouse ENSMUSG00000071103
Gene ID - Rat ENSRNOG00000038819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf47 pAb (ATL-HPA043662)
Datasheet Anti C4orf47 pAb (ATL-HPA043662) Datasheet (External Link)
Vendor Page Anti C4orf47 pAb (ATL-HPA043662) at Atlas Antibodies

Documents & Links for Anti C4orf47 pAb (ATL-HPA043662)
Datasheet Anti C4orf47 pAb (ATL-HPA043662) Datasheet (External Link)
Vendor Page Anti C4orf47 pAb (ATL-HPA043662)